CRF (bovine) trifluoroacetate salt,CAS : 92307-52-3

H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH₂ trifluoroacetate salt

Product description

CRF (bovine) trifluoroacetate salt,CAS : 92307-52-3 from ruixi.It can be applied to pituitary & hypothalamic hormones.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	92307-52-3
Sequence	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH₂
Synonyms	Corticotropin Releasing Factor, bovine
Molecular Formula	C₂₀₆H₃₄₀N₆₀O₆₃S
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of CRF (bovine) trifluoroacetate salt

Related Product

• crf-human-rat-acetate-salt